GNFOS
Created on: October 23rd, 2006
Gay n*gg*rs from outer space
Sponsorships:
| user | amount | user | amount |
|---|---|---|---|
| No one has sponsored this site ( ._.) | |||
| Sponsor this site! | Total: $0.00 | Active: $0.00 | |
Vote metrics:
| rating | total votes | favorites | comments |
|---|---|---|---|
| (3.2) | 5 | 0 | 2 |
View metrics:
| today | yesterday | this week | this month | all time |
|---|---|---|---|---|
| 0 | 2 | 2 | 2 | 2,469 |
Inbound links:
| views | url |
|---|---|
| 48 | https://www.bing.com |
| 11 | https://www.google.com/ |
| 9 | http://www.google.com.hk |
| 7 | http://www.google.com/search?sourceid=chrome&ie=UTF-8&q=gnfos |
| 3 | http://216.18.188.175:80 |
So let's play the creationist game and look at forming a peptide by random addition of amino acids. This certainly is not the way peptides formed on the early Earth, but it will be instructive.
I will use as an example the "self-replicating" peptide from the Ghadiri group mentioned above [7]. I could use other examples, such as the hexanucleotide self-replicator [10], the SunY self-replicator [24] or the RNA polymerase described by the Eckland group [12], but for historical continuity with creationist claims a small peptide is ideal. This peptide is 32 amino acids long with a sequence of RMKQLEEKVYELLSKVACLEYEVARLKKVGE and is an enzyme, a peptide ligase that makes a copy of itself from two 16 amino acid long subunits. It is also of a size and composition that is ideally suited to be formed by abiotic peptide synthesis. The fact that it is a self replicator is an added irony.
Bold
Italic
Underline
Code
User Link
Site Link